PDB entry 2ako

View 2ako on RCSB PDB site
Description: Crystal structure of Glutamate 5-kinase from Campylobacter jejuni
Class: transferase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2005-08-03, released 2005-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate 5-kinase
    Species: Campylobacter jejuni
    Gene: proB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PJ29 (Start-250)
      • modified residue (34)
      • modified residue (115-116)
      • modified residue (223)
    Domains in SCOP 1.73: d2akoa1
  • Chain 'B':
    Compound: Glutamate 5-kinase
    Species: Campylobacter jejuni
    Gene: proB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PJ29 (Start-250)
      • modified residue (34)
      • modified residue (115-116)
      • modified residue (223)
    Domains in SCOP 1.73: d2akob1
  • Chain 'C':
    Compound: Glutamate 5-kinase
    Species: Campylobacter jejuni
    Gene: proB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PJ29 (Start-250)
      • modified residue (34)
      • modified residue (115-116)
      • modified residue (223)
    Domains in SCOP 1.73: d2akoc1
  • Chain 'D':
    Compound: Glutamate 5-kinase
    Species: Campylobacter jejuni
    Gene: proB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PJ29 (Start-250)
      • modified residue (34)
      • modified residue (115-116)
      • modified residue (223)
    Domains in SCOP 1.73: d2akod1
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2akoA (A:)
    mkrivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrk
    nlinkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminl
    gilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakr
    lekithikeewlqatiktgsehgtggivtklkaakfllehnkkmflasgfdlsvaktfll
    edkqiggtlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akoA (A:)
    krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
    linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
    ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
    ekithikeewlhgtggivtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlf
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2akoB (B:)
    mkrivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrk
    nlinkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminl
    gilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakr
    lekithikeewlqatiktgsehgtggivtklkaakfllehnkkmflasgfdlsvaktfll
    edkqiggtlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akoB (B:)
    krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
    linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
    ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
    ekithikeewlhgtggivtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlf
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2akoC (C:)
    mkrivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrk
    nlinkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminl
    gilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakr
    lekithikeewlqatiktgsehgtggivtklkaakfllehnkkmflasgfdlsvaktfll
    edkqiggtlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akoC (C:)
    krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
    linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
    ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
    ekithikeewlhgtggivtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlf
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2akoD (D:)
    mkrivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrk
    nlinkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminl
    gilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakr
    lekithikeewlqatiktgsehgtggivtklkaakfllehnkkmflasgfdlsvaktfll
    edkqiggtlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akoD (D:)
    krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
    linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
    ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
    ekithikeewlhgtggivtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlf
    e