PDB entry 2akl

View 2akl on RCSB PDB site
Description: Solution structure for phn-A like protein PA0128 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: Two domains; Zn binding protein; Beta-strand protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium; NESG; Ontario Centre for Structural Proteomics; OCSP, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-08-03, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phnA-like protein pa0128
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I704 (24-135)
      • cloning artifact (22-23)
      • cloning artifact (136-137)
    Domains in SCOPe 2.08: d2akla1, d2akla2, d2akla3, d2akla4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aklA (A:)
    mgsshhhhhhssgrenlyfqghmvstlppcpqcnseytyedgallvcpecahewspneaa
    tasddgkvikdsvgnvlqdgdtitvikdlkvkgsslvvkvgtkvknirlvdgdhdidcki
    dgigamklksefvrkvgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aklA (A:)
    mvstlppcpqcnseytyedgallvcpecahewspneaatasddgkvikdsvgnvlqdgdt
    itvikdlkvkgsslvvkvgtkvknirlvdgdhdidckidgigamklksefvrkvgs