PDB entry 2ake

View 2ake on RCSB PDB site
Description: Structure of human tryptophanyl-tRNA synthetase in complex with tRNA(Trp)
Class: ligase/RNA
Keywords: Rossmann fold
Deposited on 2005-08-03, released 2006-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.23
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: HOMO SAPIENS
    Gene: WARS, WRS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2akea1
  • Chain 'B':
    Compound: transfer RNA-Trp
    Species: BOS TAURUS
  • Heterogens: SO4, TRP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2akeA (A:)
    sakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenk
    kpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqays
    yavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsd
    cigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpa
    llhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggn
    cdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevt
    deivkefmtprklsfdfqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akeA (A:)
    gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
    ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
    enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
    kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
    stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
    dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
    vkefmtprklsfd
    

  • Chain 'B':
    No sequence available.