PDB entry 2ake

View 2ake on RCSB PDB site
Description: Structure of human tryptophanyl-tRNA synthetase in complex with tRNA(Trp)
Class: ligase/RNA
Keywords: Rossmann fold, LIGASE-RNA COMPLEX
Deposited on 2005-08-03, released 2006-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS, WRS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2akea_
  • Chain 'B':
    Compound: transfer RNA-Trp
    Species: Bos taurus [TaxId:9913]
  • Heterogens: SO4, TRP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2akeA (A:)
    sakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenk
    kpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqays
    yavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsd
    cigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpa
    llhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggn
    cdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevt
    deivkefmtprklsfdfqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akeA (A:)
    gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
    ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
    enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
    kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
    stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
    dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
    vkefmtprklsfd
    

  • Chain 'B':
    No sequence available.