PDB entry 2ak1

View 2ak1 on RCSB PDB site
Description: Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with benzoic acid
Class: immune system
Keywords: catalytic Antibody, Fab, benzoic acid, HYDROLYTIC, IMMUNE SYSTEM
Deposited on 2005-08-02, released 2006-02-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.217
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody 7A1 Fab'
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AK1 (0-218)
  • Chain 'L':
    Compound: Antibody 7A1 Fab'
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AK1 (0-215)
    Domains in SCOPe 2.03: d2ak1l1, d2ak1l2
  • Heterogens: ZN, BEZ, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ak1L (L:)
    divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
    sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr