PDB entry 2aju

View 2aju on RCSB PDB site
Description: Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
Class: immune system
Keywords: CATALYTIC Antibody, Fab, COCAINE, HYDROLYTIC, IMMUNE SYSTEM
Deposited on 2005-08-02, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody 7A1 Fab'
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2AJU (0-218)
  • Chain 'L':
    Compound: Antibody 7A1 Fab'
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2AJU (0-215)
    Domains in SCOPe 2.07: d2ajul1, d2ajul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajuL (L:)
    divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
    sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr