PDB entry 2ajl

View 2ajl on RCSB PDB site
Description: X-ray Structure of Novel Biaryl-Based Dipeptidyl peptidase IV inhibitor
Class: hydrolase
Keywords: Aminopeptidase, hydrolase, protease, serine protease
Deposited on 2005-08-02, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ajli1, d2ajli2
  • Chain 'J':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ajlj1, d2ajlj2
  • Heterogens: NAG, JNH, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ajlI (I:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ajlI (I:)
    ktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefgh
    sindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspv
    ghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspng
    tflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvt
    natsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwncl
    varqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkg
    twevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvs
    fskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiiln
    etkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdg
    rgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvl
    gsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqvey
    llihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfik
    qcfslp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajlJ (J:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp