PDB entry 2ajd

View 2ajd on RCSB PDB site
Description: Porcine dipeptidyl peptidase IV (CD26) in complex with L-Pro-boro-L-Pro (boroPro)
Class: hydrolase
Keywords: Serine protease, dipeptidyl peptidase, alpha/beta-hydrolase, beta-propeller, oxyanion hole, substrate channeling, drug design, diabetes mellitus, flexibility, HYDROLASE
Deposited on 2005-08-01, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ajda1, d2ajda2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ajdb1, d2ajdb2
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ajdc1, d2ajdc2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ajdd1, d2ajdd2
  • Heterogens: NAG, SO4, BPR, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajdA (A:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajdB (B:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajdC (C:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajdD (D:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp