PDB entry 2ajc

View 2ajc on RCSB PDB site
Description: Porcine dipeptidyl peptidase IV (CD26) in complex with 4-(2-Aminoethyl)-benzene sulphonyl fluoride (AEBSF)
Class: hydrolase/hydrolase inhibitor
Keywords: Serine protease, dipeptidyl peptidase, alpha/beta-hydrolase, beta-propeller, oxyanion hole, substrate channeling, drug design, diabetes mellitus, flexibility, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2005-08-01, released 2006-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ajca1, d2ajca2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ajcb1, d2ajcb2
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ajcc1, d2ajcc2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ajcd1, d2ajcd2
  • Heterogens: NAG, SO4, AES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajcA (A:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajcB (B:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajcC (C:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajcD (D:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp