PDB entry 2aja

View 2aja on RCSB PDB site
Description: X-Ray structure of an ankyrin repeat family protein Q5ZSV0 from Legionella pneumophila. Northeast Structural Genomics Consortium target LgR21.
Class: protein binding
Keywords: X-Ray structure, NESG, Q5ZSV0, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, PROTEIN BINDING
Deposited on 2005-08-01, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ankyrin repeat family protein
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSV0
      • modified residue (41)
      • modified residue (59)
      • modified residue (155)
      • modified residue (157)
      • modified residue (192)
      • modified residue (223)
      • modified residue (253)
      • modified residue (280)
    Domains in SCOPe 2.07: d2ajaa1
  • Chain 'B':
    Compound: ankyrin repeat family protein
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSV0
      • modified residue (41)
      • modified residue (59)
      • modified residue (155)
      • modified residue (157)
      • modified residue (192)
      • modified residue (223)
      • modified residue (253)
      • modified residue (280)
    Domains in SCOPe 2.07: d2ajab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ajaA (A:)
    mcnltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknm
    eqvrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllltsdei
    vkviqaenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvln
    rlcelapteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyv
    npfiarhvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirfl
    lsipgikalaptatipgdanellrlalrlgnqgacalllsipsvlaltkannyyinetgg
    rldlravalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ajaA (A:)
    nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq
    vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllsdeivkqa
    enyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrlcela
    pteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnpfiar
    hvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirfllsipgi
    kalaptatipgdanellrlalrlgnqgacalllsipsvlaltk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ajaB (B:)
    mcnltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknm
    eqvrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllltsdei
    vkviqaenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvln
    rlcelapteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyv
    npfiarhvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirfl
    lsipgikalaptatipgdanellrlalrlgnqgacalllsipsvlaltkannyyinetgg
    rldlravalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ajaB (B:)
    cnltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknme
    qvrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllsdeivkq
    aenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrlcel
    apteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnpfia
    rhvnrlkemhdafklsnpvtkseclqgfymlrnlirrndevllddirfllsipgikalap
    tatipgdanellrlalrlgnqgacalllsipsvlaltkannyyin