PDB entry 2aj9

View 2aj9 on RCSB PDB site
Description: X-ray crystal structure of W42A,R161A double mutant of Mycobacterium tuberculosis beta-ketoacyl-ACP synthase III
Class: transferase
Keywords: beta-ketoacyl-ACP synthase III, 3-oxoacyl-ACP synthase III, mtFabH, FabH, TRANSFERASE
Deposited on 2005-08-01, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A574 (21-End)
      • engineered (62)
      • engineered (181)
    Domains in SCOPe 2.07: d2aj9a1, d2aj9a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A574 (21-End)
      • engineered (62)
      • engineered (181)
    Domains in SCOPe 2.07: d2aj9b1, d2aj9b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aj9A (A:)
    mgsshhhhhhssglvprgsvcmteiattsgarsvgllsvgayrpervvtndeicqhidss
    deaiytrtgiktrrfaaddesaasmateacrralsnaglsaadidgvivttnthflqtpp
    aapmvaaslgakgilgfdlsagcagfgyalgaaadmirgggaatmlvvgteklsptidmy
    dagncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwitfaqnpsgprpfv
    rlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrpdav
    vandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj9A (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdeaiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydagncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aj9B (B:)
    mgsshhhhhhssglvprgsvcmteiattsgarsvgllsvgayrpervvtndeicqhidss
    deaiytrtgiktrrfaaddesaasmateacrralsnaglsaadidgvivttnthflqtpp
    aapmvaaslgakgilgfdlsagcagfgyalgaaadmirgggaatmlvvgteklsptidmy
    dagncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwitfaqnpsgprpfv
    rlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrpdav
    vandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj9B (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdeaiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydagncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk