PDB entry 2aj7

View 2aj7 on RCSB PDB site
Description: Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution
Class: contractile protein
Keywords: Bh3618-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, contractile protein
Deposited on 2005-08-01, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.167
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BH3618
    Species: Bacillus halodurans [TaxId:86665]
    Gene: 10176242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K6V7 (12-End)
      • leader sequence (3-11)
      • modified residue (12)
      • see remark 999 (20)
      • see remark 999 (52-53)
      • see remark 999 (92)
      • modified residue (133)
      • see remark 999 (145)
    Domains in SCOPe 2.07: d2aj7a1, d2aj7a2
  • Chain 'B':
    Compound: hypothetical protein BH3618
    Species: Bacillus halodurans [TaxId:86665]
    Gene: 10176242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K6V7 (12-End)
      • leader sequence (9-11)
      • modified residue (12)
      • see remark 999 (20)
      • see remark 999 (52-53)
      • see remark 999 (92)
      • modified residue (133)
      • see remark 999 (145)
    Domains in SCOPe 2.07: d2aj7b2, d2aj7b3
  • Heterogens: NI, K, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aj7A (A:)
    mgsdkihhhhhhmkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyyt
    lqstktvdlafiivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettv
    nlqapivinankqmgkqlvlgdtaynrkqplfqkelvlakeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj7A (A:)
    dkihhhhhhmkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqs
    tktvdlafiivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlq
    apivinankqmgkqlvlgdtaynrkqplfqkelvlak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aj7B (B:)
    mgsdkihhhhhhmkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyyt
    lqstktvdlafiivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettv
    nlqapivinankqmgkqlvlgdtaynrkqplfqkelvlakeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj7B (B:)
    hhhmkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqstktvdl
    afiivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlqapivin
    ankqmgkqlvlgdtaynrkqplfqkelvl