PDB entry 2aj6

View 2aj6 on RCSB PDB site
Description: Crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 A resolution
Class: transferase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, transferase
Deposited on 2005-08-01, released 2005-08-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.181
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein MW0638
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Gene: np_645455.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXQ8 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (54)
      • modified residue (89)
      • modified residue (121)
    Domains in SCOPe 2.03: d2aj6a1
  • Heterogens: SO4, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aj6A (A:)
    mgsdkihhhhhhmrtlnkdehnyikqianihetllsqvesnykctklsialryemicsrl
    ehtndkiyiyenegqliafiwghfsneksmvniellyvepqfrklgiatqlkialekwak
    tmnakrisntihknnlpmislnkdlgyqvshvkmykdid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj6A (A:)
    hhmrtlnkdehnyikqianihetllsqvesnykctklsialryemicsrlehtndkiyiy
    enegqliafiwghfsneksmvniellyvepqfrklgiatqlkialekwaktmnakrisnt