PDB entry 2aj3

View 2aj3 on RCSB PDB site
Description: Crystal Structure of a Cross-Reactive HIV-1 Neutralizing CD4-Binding Site Antibody Fab m18
Class: immune system
Keywords: HIV, antibody, Fab, CD4-binding, immunoglobulin, IMMUNE SYSTEM
Deposited on 2005-08-01, released 2006-03-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab m18, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Fab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aj3a1, d2aj3a2
  • Chain 'B':
    Compound: Fab m18, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Fab
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fab m18, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Fab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aj3c1, d2aj3c2
  • Chain 'D':
    Compound: Fab m18, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Fab
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Fab m18, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Fab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aj3e1, d2aj3e2
  • Chain 'F':
    Compound: Fab m18, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Fab
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aj3A (A:)
    lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
    fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleisrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdnkdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj3A (A:)
    lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
    fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleisrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdnkdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aj3C (C:)
    lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
    fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleisrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdnkdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj3C (C:)
    lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
    fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleisrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdnkdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aj3E (E:)
    lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
    fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleisrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdnkdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj3E (E:)
    lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
    fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleisrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdnkdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    No sequence available.