PDB entry 2aj2

View 2aj2 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein VC0467 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR8.
Class: unknown function
Keywords: X-Ray structure, NESG, VcR8, Q9KUP8, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-08-01, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.258
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0301 protein VC0467
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KUP8 (13-End)
      • cloning artifact (5-12)
      • modified residue (13)
      • modified residue (23)
      • modified residue (26)
      • modified residue (47)
      • modified residue (50)
      • modified residue (62)
      • modified residue (109)
      • modified residue (111)
    Domains in SCOPe 2.07: d2aj2a1, d2aj2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aj2A (A:)
    msnhssdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditv
    ggmlkqvdiepaypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavtt
    skdiltvlgteaepegyivalgysgwsagqleveltenswltieadpelifntpvhekwq
    kaiqklgispaqlssdaghalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aj2A (A:)
    sdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlk
    qvdiepaypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdil
    tvlgteaepegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqk
    lgispaq