PDB entry 2aiz

View 2aiz on RCSB PDB site
Description: Solution structure of peptidoglycan associated lipoprotein from Haemophilus influenza bound to UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine
Class: membrane protein
Keywords: alpha-beta sandwich, Structure 2 Function Project, S2F, Structural Genomics, MEMBRANE PROTEIN
Deposited on 2005-08-01, released 2006-03-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Outer membrane protein P6
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pal, ompP6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2aizp1
  • Chain 'U':
    Compound: UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine
    Database cross-references and differences (RAF-indexed):
    • PDB 2AIZ (0-6)

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2aizP (P:)
csssnndaagngaaqtfggysvadlqqryntvyfgfdkyditgeyvqildahaaylnatp
aakvlvegntdergtpeynialgqrradavkgylagkgvdagklgtvsygeekpavlghd
eaaysknrravlay

  • Chain 'U':
    No sequence available.