PDB entry 2aip

View 2aip on RCSB PDB site
Description: Crystal structure of native protein C activator from the venom of copperhead snake Agkistrodon contortrix contortrix
Class: hydrolase
Keywords: Protein C activator, snake venom, trypsin-like enzyme, hydrolase
Deposited on 2005-07-30, released 2005-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.171
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein C activator
    Species: Agkistrodon contortrix contortrix [TaxId:8713]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aipa_
  • Heterogens: NAG, NDG, SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aipA (A:)
    viggdecninehrflalvyangslcggtlinqewvltarhcdrgnmriylgmhnlkvlnk
    dalrrfpkekyfclntrndtiwdkdimlirlnrpvrnsahiaplslpsnppsvgsvcrim
    gwgtitspnatlpdvphcaninildyavcqaaykglaattlcagileggkdtckgdsggp
    licngqfqgilsvggnpcaqprkpgiytkvfdytdwiqsiisgntdatcpp