PDB entry 2aif

View 2aif on RCSB PDB site
Description: Crystal Structure of High Mobility Like Protein, NHP2, putative from Cryptosporidium parvum
Class: DNA binding protein, cytokine
Keywords: ribosomal protein, High-mobility like protein, Transcription factor, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN, CYTOKINE
Deposited on 2005-07-29, released 2005-08-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosomal protein L7A
  Species: Cryptosporidium parvum [TaxId:5807]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7YYQ3
  Domains in SCOPe 2.03: d2aifa1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2aifA (A:)
  gssqneasedtgfnpkafplaspdlnnkiinlvqqacnykqlrkganeatkalnrgiaei
  vllaadaepleillhlplvcedkntpyvfvrskvalgracgvsrpviaaaitskdgssls
  sqitelkdqieqilv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2aifA (A:)
  fplaspdlnnkiinlvqqacnykqlrkganeatkalnrgiaeivllaadaepleillhlp
  lvcedkntpyvfvrskvalgracgvsrpviaaaitskdgsslssqitelkdqieq