PDB entry 2aid

View 2aid on RCSB PDB site
Description: structure of a non-peptide inhibitor complexed with hiv-1 protease: developing a cycle of structure-based drug design
Class: aspartyl protease
Keywords: aspartyl protease, hiv, non-peptide inhibitor, drug design
Deposited on 1997-04-17, released 1997-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human immunodeficiency virus protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOPe 2.04: d2aida_
  • Chain 'B':
    Compound: human immunodeficiency virus protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOPe 2.04: d2aidb_
  • Heterogens: CL, THK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aidA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aidB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf