PDB entry 2ai6

View 2ai6 on RCSB PDB site
Description: Solution structure of human phosphohistidine phosphatase 1
Class: hydrolase
Keywords: alpha/beta architecture, HYDROLASE
Deposited on 2005-07-29, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14 kDa phosphohistidine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ai6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ai6A (A:)
    mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
    sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
    andgy