PDB entry 2ai6

View 2ai6 on RCSB PDB site
Description: Solution structure of human phosphohistidine phosphatase 1
Class: hydrolase
Keywords: alpha/beta architecture, HYDROLASE
Deposited on 2005-07-29, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 14 kDa phosphohistidine phosphatase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NRX4 (0-124)
  Domains in SCOPe 2.08: d2ai6a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ai6A (A:)
  mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
  sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
  andgy