PDB entry 2ai5

View 2ai5 on RCSB PDB site
Description: Solution Structure of Cytochrome C552, determined by Distributed Computing Implementation for NMR data
Class: electron transport
Keywords: cytochrome C, electron transport, porphyrin, ferrous iron
Deposited on 2005-07-29, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c-552
  Species: Hydrogenobacter thermophilus [TaxId:940]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15452 (0-79)
  Domains in SCOPe 2.08: d2ai5a_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ai5A (A:)
  neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
  pqnvtdaeakqlaqwilsik