PDB entry 2ai1

View 2ai1 on RCSB PDB site
Description: Purine nucleoside phosphorylase from calf spleen
Class: transferase
Keywords: purine nucleoside phosphorylase, multisubstrate analog inhibitor, TRANSFERASE
Deposited on 2005-07-28, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ai1a_
  • Heterogens: MG, ZN, 144, P1G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ai1A (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai1A (A:)
    ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpesgrl
    vfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfevgd
    imlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqrelq
    egtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvimd
    yesqgkanheevleagkqaaqkleqfvsllmasi