PDB entry 2ahw

View 2ahw on RCSB PDB site
Description: Crystal Structure of Acyl-CoA transferase from E. coli O157:H7 (YdiF)-thioester complex with CoA- 2
Class: transferase
Keywords: YdiF, CoA transferase, Glutamyl thioester, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, TRANSFERASE
Deposited on 2005-07-28, released 2005-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative enzyme YdiF
    Species: Escherichia coli [TaxId:83334]
    Gene: YdiF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahwa1, d2ahwa2
  • Chain 'B':
    Compound: putative enzyme YdiF
    Species: Escherichia coli [TaxId:83334]
    Gene: YdiF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahwb1, d2ahwb2
  • Chain 'C':
    Compound: putative enzyme YdiF
    Species: Escherichia coli [TaxId:83334]
    Gene: YdiF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahwc1, d2ahwc2
  • Chain 'D':
    Compound: putative enzyme YdiF
    Species: Escherichia coli [TaxId:83334]
    Gene: YdiF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahwd1, d2ahwd2
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahwA (A:)
    mkpvkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtp
    rnlsiisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgv
    ltqtlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaia
    pdiafirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksv
    ripgylvdivvvdpdqsqlyggapvnrfisgdftlddstklslplnqrklvarralfemr
    kgavgnvgvgiadgiglvareegcaddfiltvetgpiggitsqgiafganvntraildmt
    sqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisatskkiifcgtlta
    gslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryiteravftlkedgl
    hlieiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlpeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahwA (A:)
    vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
    siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
    tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
    afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
    gylvdivvvdpdqsqlyggapvnrfisgdftldplnqrklvarralfemrkgavgnvgvg
    iadgiglvareegcaddfiltvetgpiggitanvntraildmtsqfdfyhgggldvcyls
    faevdqhgnvgvhkfngkimgtggfidisatskkiifcgtltagslkteiadgklnivqe
    grvkkfirelpeitfsgkialergldvryiteravftlkedglhlieiapgvdlqkdild
    kmdftpvispelklmderlfidaamgfvlpea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ahwB (B:)
    mkpvkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtp
    rnlsiisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgv
    ltqtlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaia
    pdiafirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksv
    ripgylvdivvvdpdqsqlyggapvnrfisgdftlddstklslplnqrklvarralfemr
    kgavgnvgvgiadgiglvareegcaddfiltvetgpiggitsqgiafganvntraildmt
    sqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisatskkiifcgtlta
    gslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryiteravftlkedgl
    hlieiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlpeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahwB (B:)
    vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
    siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
    tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
    afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
    gylvdivvvdpdqsqlyggapvnrfisgdftldplnqrklvarralfemrkgavgnvgvg
    iadgiglvareegcaddfiltvetgpiggitanvntraildmtsqfdfyhgggldvcyls
    faevdqhgnvgvhkfngkimgtggfidisatskkiifcgtltagslkteiadgklnivqe
    grvkkfirelpeitfsgkialergldvryiteravftlkedglhlieiapgvdlqkdild
    kmdftpvispelklmderlfidaamgfvlpea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ahwC (C:)
    mkpvkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtp
    rnlsiisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgv
    ltqtlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaia
    pdiafirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksv
    ripgylvdivvvdpdqsqlyggapvnrfisgdftlddstklslplnqrklvarralfemr
    kgavgnvgvgiadgiglvareegcaddfiltvetgpiggitsqgiafganvntraildmt
    sqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisatskkiifcgtlta
    gslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryiteravftlkedgl
    hlieiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlpeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahwC (C:)
    vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
    siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
    tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
    afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
    gylvdivvvdpdqsqlyggapvnrfisgdftldplnqrklvarralfemrkgavgnvgvg
    iadgiglvareegcaddfiltvetgpiggitanvntraildmtsqfdfyhgggldvcyls
    faevdqhgnvgvhkfngkimgtggfidisatskkiifcgtltagslkteiadgklnivqe
    grvkkfirelpeitfsgkialergldvryiteravftlkedglhlieiapgvdlqkdild
    kmdftpvispelklmderlfidaamgfvlpea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ahwD (D:)
    mkpvkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtp
    rnlsiisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgv
    ltqtlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaia
    pdiafirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksv
    ripgylvdivvvdpdqsqlyggapvnrfisgdftlddstklslplnqrklvarralfemr
    kgavgnvgvgiadgiglvareegcaddfiltvetgpiggitsqgiafganvntraildmt
    sqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisatskkiifcgtlta
    gslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryiteravftlkedgl
    hlieiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlpeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahwD (D:)
    vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
    siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
    tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
    afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
    gylvdivvvdpdqsqlyggapvnrfisgdftldplnqrklvarralfemrkgavgnvgvg
    iadgiglvareegcaddfiltvetgpiggitanvntraildmtsqfdfyhgggldvcyls
    faevdqhgnvgvhkfngkimgtggfidisatskkiifcgtltklnivqegfielpeitfs
    gkialergldvryiteravftlkedlhlieiapgvdldftpvispelklmderlfidaam
    gfvlpea