PDB entry 2ahr

View 2ahr on RCSB PDB site
Description: Crystal Structures of 1-Pyrroline-5-Carboxylate Reductase from Human Pathogen Streptococcus pyogenes
Class: oxidoreductase
Keywords: 1-Pyrroline-5-Carboxylate Reductase, Pyrroline-5-Carboxylate Reductase, Pyrroline Reductase, Proline biosynthesis, NAD(P)binding protein, Rossmann Fold, Doain swapping, human pathogen, Streptococcus pyogenes, Structural Genomics, MCSG, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2005-07-28, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative pyrroline carboxylate reductase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A1S9 (3-258)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (13)
      • modified residue (51)
      • modified residue (88)
      • modified residue (111)
      • modified residue (114)
      • modified residue (233)
    Domains in SCOPe 2.07: d2ahra1, d2ahra2, d2ahra3
  • Chain 'B':
    Compound: putative pyrroline carboxylate reductase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A1S9 (3-258)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (13)
      • modified residue (51)
      • modified residue (88)
      • modified residue (111)
      • modified residue (114)
      • modified residue (233)
    Domains in SCOPe 2.07: d2ahrb1, d2ahrb2, d2ahrb3
  • Chain 'C':
    Compound: putative pyrroline carboxylate reductase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A1S9 (3-258)
      • modified residue (3)
      • modified residue (13)
      • modified residue (51)
      • modified residue (88)
      • modified residue (111)
      • modified residue (114)
      • modified residue (233)
    Domains in SCOPe 2.07: d2ahrc1, d2ahrc2
  • Chain 'D':
    Compound: putative pyrroline carboxylate reductase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A1S9 (3-258)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (13)
      • modified residue (51)
      • modified residue (88)
      • modified residue (111)
      • modified residue (114)
      • modified residue (233)
    Domains in SCOPe 2.07: d2ahrd1, d2ahrd2, d2ahrd3
  • Chain 'E':
    Compound: putative pyrroline carboxylate reductase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A1S9 (3-258)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (13)
      • modified residue (51)
      • modified residue (88)
      • modified residue (111)
      • modified residue (114)
      • modified residue (233)
    Domains in SCOPe 2.07: d2ahre1, d2ahre2, d2ahre3
  • Heterogens: NA, NAP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahrA (A:)
    snamkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidq
    vdlvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqil
    qsstaltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfieala
    kagvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlg
    ltatvssaidktidkaksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahrA (A:)
    amkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvd
    lvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqs
    staltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfiealaka
    gvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlglt
    atvssaidktidkaksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ahrB (B:)
    snamkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidq
    vdlvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqil
    qsstaltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfieala
    kagvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlg
    ltatvssaidktidkaksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahrB (B:)
    amkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvd
    lvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqs
    staltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfiealaka
    gvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlglt
    atvssaidktidkaksl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ahrC (C:)
    snamkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidq
    vdlvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqil
    qsstaltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfieala
    kagvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlg
    ltatvssaidktidkaksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahrC (C:)
    mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl
    vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss
    taltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfiealakag
    vkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlglta
    tvssaidktidkaksl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ahrD (D:)
    snamkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidq
    vdlvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqil
    qsstaltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfieala
    kagvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlg
    ltatvssaidktidkaksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahrD (D:)
    namkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqv
    dlvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilq
    sstaltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfiealak
    agvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlgl
    tatvssaidktidkaksl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahrE (E:)
    snamkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidq
    vdlvilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqil
    qsstaltgnalvsqelqarvrdltdsfgstfdisekdfdtftalagsspayiylfieala
    kagvkngipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglmelerlg
    ltatvssaidktidkaksl