PDB entry 2ahp

View 2ahp on RCSB PDB site
Description: GCN4 leucine zipper, mutation of Lys15 to epsilon-azido-Lys
Class: de novo protein
Keywords: GCN4, coiled coil, azide, DE NOVO PROTEIN
Deposited on 2005-07-28, released 2006-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • modified residue (13)
  Domains in SCOPe 2.08: d2ahpa1
• Chain 'B':
  Compound: General control protein GCN4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-End)
    • modified residue (13)
  Domains in SCOPe 2.08: d2ahpb1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ahpA (A:)
  rmkqledkveellkknyhlenevarlkklvger
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2ahpB (B:)
  rmkqledkveellkknyhlenevarlkklvger
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ahpB (B:)
  rmkqledkveellkknyhlenevarlkklvge