PDB entry 2ahk

View 2ahk on RCSB PDB site
Description: Crystal structure of the met-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months
Class: oxidoreductase/metal transport
Keywords: tyrosinase, binary complex, oxidoreductase-metal transport complex
Deposited on 2005-07-28, released 2006-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Streptomyces castaneoglobisporus [TaxId:79261]
    Gene: TYRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ahka_
  • Chain 'B':
    Compound: caddie protein orf378
    Species: Streptomyces castaneoglobisporus [TaxId:79261]
    Gene: ORF378
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ahkb_
  • Heterogens: CU, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahkA (A:)
    mtvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsfl
    pwhrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpf
    aastgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnh
    legwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptgg
    tpdvvdlnetmkpwntvrpadlldhtayytfdalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahkA (A:)
    tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
    whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
    astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
    egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
    pdvvdlnetmkpwntvrpadlldhtayytfdal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ahkB (B:)
    mpeitrrraltaaaavaatasaavtlaapaasaaghhepaapesfdevykgrriqgrpar
    gaahhhehgggyevfvdgvqlhvmrnadgswisvvshydpvptpraaaraavdelqgapl
    lpfpanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahkB (B:)
    aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
    avdelqgapllp