PDB entry 2ahj

View 2ahj on RCSB PDB site
Description: nitrile hydratase complexed with nitric oxide
Deposited on 1997-12-24, released 1999-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2ahja_
  • Chain 'B':
    Domains in SCOP 1.55: d2ahjb_
  • Chain 'C':
    Domains in SCOP 1.55: d2ahjc_
  • Chain 'D':
    Domains in SCOP 1.55: d2ahjd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahjA (A:)
    idhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvara
    wtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslasctawpilglp
    ptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsq
    eqlqeivtkdcligvaipqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahjA (A:)
    idhpaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpef
    rqllltdgtaavaqygylgpqgeyivavedtptlknvivcslasctawpilglpptwyks
    feyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqei
    vtkdcligvaipqv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahjB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ahjC (C:)
    idhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvara
    wtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslasctawpilglp
    ptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsq
    eqlqeivtkdcligvaipqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahjC (C:)
    idhapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslasctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahjD (D:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa