PDB entry 2ahj

View 2ahj on RCSB PDB site
Description: nitrile hydratase complexed with nitric oxide
Class: lyase
Keywords: lyase, photoreactive enzyme, nitric oxide binding enzyme, non-heme iron center, post-translational modification of cysteine residues, hydratase
Deposited on 1997-12-24, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrile hydratase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448
      • modification (111)
      • modification (113)
    Domains in SCOPe 2.07: d2ahja_
  • Chain 'B':
    Compound: nitrile hydratase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahjb_
  • Chain 'C':
    Compound: nitrile hydratase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448
      • modification (111)
      • modification (113)
    Domains in SCOPe 2.07: d2ahjc_
  • Chain 'D':
    Compound: nitrile hydratase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahjd_
  • Heterogens: FE, ZN, SO4, NO, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahjA (A:)
    svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelv
    arawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpil
    glpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagteg
    wsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahjA (A:)
    idhpaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpef
    rqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyks
    feyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqei
    vtkdcligvaipqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ahjB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahjB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ahjC (C:)
    svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelv
    arawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpil
    glpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagteg
    wsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahjC (C:)
    idhapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahjD (D:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa