PDB entry 2ahg

View 2ahg on RCSB PDB site
Description: Unsaturated glucuronyl hydrolase mutant D88N with dGlcA-GalNAc
Class: hydrolase
Keywords: alpha6/alpha6 barrel, glycoside hydrolase family 88, complex with unsaturated chondroitin disaccharide, HYDROLASE
Deposited on 2005-07-28, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC92 (0-376)
      • engineered (87)
    Domains in SCOPe 2.06: d2ahga_
  • Chain 'B':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC92 (0-376)
      • engineered (87)
    Domains in SCOPe 2.06: d2ahgb_
  • Heterogens: UCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahgA (A:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahgB (B:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr