PDB entry 2ahd

View 2ahd on RCSB PDB site
Description: The Apo structure of Methanococcus jannaschii phosphodiesterase MJ0936
Class: hydrolase
Keywords: phosphodiesterase, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, HYDROLASE
Deposited on 2005-07-27, released 2005-08-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphodiesterase MJ0936
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ahda_
  • Chain 'B':
    Compound: Phosphodiesterase MJ0936
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ahdb_
  • Chain 'C':
    Compound: Phosphodiesterase MJ0936
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ahdc_
  • Chain 'D':
    Compound: Phosphodiesterase MJ0936
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ahdd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahdA (A:)
    mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
    dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
    thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahdB (B:)
    mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
    dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
    thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahdC (C:)
    mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
    dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
    thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ahdD (D:)
    mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
    dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
    thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl