PDB entry 2ah7

View 2ah7 on RCSB PDB site
Description: Crystal structure of nitrophorin 2 aqua complex
Class: transport protein
Keywords: beta barrel, lipocalin, ferric heme, TRANSPORT PROTEIN
Deposited on 2005-07-27, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (1-179)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d2ah7x2, d2ah7x3
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ah7X (X:)
    mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
    ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
    iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl