PDB entry 2agq

View 2agq on RCSB PDB site
Description: Fidelity of Dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis
Class: transferase/DNA
Keywords: base stacking, fidelity, metal ion, mismatch, pyrophosphorolysis
Deposited on 2005-07-27, released 2005-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: Sulfolobus solfataricus
    Gene: dbh, dpo4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2agqa1, d2agqa2
  • Chain 'B':
    Compound: 5'-d(*gp*gp*cp*tp*ap*cp*ap*gp*gp*ap*cp*tp*(doc))-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*tp*cp*ap*tp*gp*ap*gp*tp*cp*cp*tp*gp*tp*ap*gp*cp*c)-3'
    Species: synthetic, synthetic
  • Heterogens: CA, MG, DTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2agqA (A:)
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.