PDB entry 2agj

View 2agj on RCSB PDB site
Description: Crystal Structure of a glycosylated Fab from an IgM cryoglobulin with properties of a natural proteolytic antibody
Class: immune system
Keywords: Antibody, Immunoglobulin superfamily, catalytic antibody, IMMUNE SYSTEM
Deposited on 2005-07-27, released 2006-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Yvo Fab, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2agjh1, d2agjh2
  • Chain 'L':
    Compound: Yvo Fab, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2agjl1, d2agjl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2agjH (H:)
    evtlkesgptlvkptqtltltctfsgfsltttgegvgwirqppgkaleflafiywndakr
    ynpslqsrltitkdaskkqvvltltnldpvdtatyycartsgwdiefeywgqgtlvtvss
    gsasaptlfplvscensspsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
    ggkyaatsqvllpskdvmqgtdehvvckvqhpngnkekdvplpvvi
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2agjL (L:)
    eivltqspgtlslspgeratlscrasetvsndkvawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftlsisglepedfvvyycqqyassprtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec