PDB entry 2agi

View 2agi on RCSB PDB site
Description: The leupeptin-trypsin covalent complex at 1.14 A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: Acyl-enzyme, serine protease, proteinase, peptidase, hydrolase, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-07-26, released 2006-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.117
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leupeptin
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00487 (Start-2)
  • Chain 'X':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2agix_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2agiX (X:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn