PDB entry 2age

View 2age on RCSB PDB site
Description: Succinyl-AAPR-trypsin acyl-enzyme at 1.15 A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: acyl-enzyme, serine protease, proteinase, peptidase, hydrolase-hydrolase inhibitor complex
Deposited on 2005-07-26, released 2006-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.12
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-Ala-Ala-Pro-Arg
    Database cross-references and differences (RAF-indexed):
    • PDB 2AGE (0-4)
  • Chain 'X':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2agex_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ageX (X:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn