PDB entry 2age

View 2age on RCSB PDB site
Description: Succinyl-AAPR-trypsin acyl-enzyme at 1.15 A resolution
Class: hydrolase
Keywords: Acyl-enzyme; serine protease; proteinase; peptidase; hydrolase
Deposited on 2005-07-26, released 2006-05-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.12
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-Ala-Ala-Pro-Arg
  • Chain 'X':
    Compound: beta-trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2agex1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ageX (X:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn