PDB entry 2agc

View 2agc on RCSB PDB site
Description: Crystal Structure of mouse GM2- activator Protein
Class: lipid binding protein
Keywords: constricted lipid binding pocket, LIPID BINDING PROTEIN
Deposited on 2005-07-26, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ganglioside GM2 activator
  Species: Mus musculus [TaxId:10090]
  Gene: GM2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60648 (0-161)
  Domains in SCOPe 2.08: d2agca_
• Heterogens: MYR, DAO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2agcA (A:)
  ggfswdncdegkdpaviksltiqpdpivvpgdvvvslegktsvpltapqkveltvekeva
  gfwvkipcveqlgscsyenicdlideyippgescpeplhtyglpchcpfkegtyslptsn
  ftvpdlelpswlstgnyriqsilssggkrlgcikiaaslkgr