PDB entry 2ag5

View 2ag5 on RCSB PDB site
Description: Crystal Structure of Human DHRS6
Class: oxidoreductase
Keywords: PROTEIN-co-FACTOR complex , Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-07-26, released 2005-08-09
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.168
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dehydrogenase/reductase (SDR family) member 6
    Species: HOMO SAPIENS
    Gene: DHRS6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BUT1 (0-244)
      • cloning artifact (245)
    Domains in SCOP 1.75: d2ag5a1
  • Chain 'B':
    Compound: dehydrogenase/reductase (SDR family) member 6
    Species: HOMO SAPIENS
    Gene: DHRS6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BUT1 (Start-244)
      • cloning artifact (245)
    Domains in SCOP 1.75: d2ag5b1
  • Chain 'C':
    Compound: dehydrogenase/reductase (SDR family) member 6
    Species: HOMO SAPIENS
    Gene: DHRS6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ag5c1
  • Chain 'D':
    Compound: dehydrogenase/reductase (SDR family) member 6
    Species: HOMO SAPIENS
    Gene: DHRS6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ag5d1
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ag5A (A:)
    mgrldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvt
    kkkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkm
    laqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtv
    dtpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviid
    ggwslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ag5B (B:)
    mgrldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvt
    kkkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkm
    laqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtv
    dtpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviid
    ggwslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ag5B (B:)
    grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk
    kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml
    aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd
    tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg
    gwslg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ag5C (C:)
    mgrldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvt
    kkkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkm
    laqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtv
    dtpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviid
    ggwslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ag5C (C:)
    grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk
    kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml
    aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd
    tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg
    gwsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ag5D (D:)
    mgrldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvt
    kkkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkm
    laqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtv
    dtpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviid
    ggwslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ag5D (D:)
    grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk
    kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml
    aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd
    tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg
    gwsl