PDB entry 2afw

View 2afw on RCSB PDB site
Description: Crystal structure of human glutaminyl cyclase in complex with N-acetylhistamine
Class: transferase
Keywords: alpha-beta protein, metalloprotein, TRANSFERASE
Deposited on 2005-07-26, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.189
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2afwa_
  • Chain 'B':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2afwb_
  • Heterogens: ZN, SO4, AHN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2afwA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afwA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh
    laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
    helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
    ldestidnlnkilqvfvleylhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2afwB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afwB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh
    laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
    helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
    ldestidnlnkilqvfvleylhl