PDB entry 2afp

View 2afp on RCSB PDB site
Description: the solution structure of type ii antifreeze protein reveals a new member of the lectin family
Deposited on 1998-12-14, released 1998-12-23
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d2afpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2afpA (A:)
  qragpncpagwqplgdrciyyettamtwalaetncmklgghlasihsqeehsfiqtlnag
  vvwiggsaclqagawtwsdgtpmnfrswcstkpddvlaaccmqmtaaadqcwddlpcpas
  hksvcamtf