PDB entry 2afj

View 2afj on RCSB PDB site
Description: SPRY domain-containing SOCS box protein 2 (SSB-2)
Class: gene regulation
Keywords: beta sandwich, GENE REGULATION
Deposited on 2005-07-26, released 2006-01-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene rich cluster, C9 gene
    Species: Mus musculus [TaxId:10090]
    Gene: Ssb-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88838 (6-218)
      • cloning artifact (0-5)
      • cloning artifact (219-225)
    Domains in SCOPe 2.08: d2afja1, d2afja2, d2afja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afjA (A:)
    gssarqstptsqalysdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglc
    ferrpvaqstdgvrgkrgysrglhaweiswpleqrgthavvgvatalaplqadhyaallg
    snseswgwdigrgklyhqskgleapqypagpqgeqlvvperllvvldmeegtlgysiggt
    ylgpafrglkgrtlypsvsavwgqcqvrirymgerrveetrrihrd