PDB entry 2afi

View 2afi on RCSB PDB site
Description: Crystal Structure of MgADP bound Av2-Av1 Complex
Class: oxidoreductase
Keywords: Nitrogen fixation, Iron-sulfur, Metal-binding, Molybdenum, oxidoreductase
Deposited on 2005-07-25, released 2005-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afia_
  • Chain 'B':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afib_
  • Chain 'C':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afic_
  • Chain 'D':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afid_
  • Chain 'E':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afie_
  • Chain 'F':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afif_
  • Chain 'G':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afig_
  • Chain 'H':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afih_
  • Chain 'I':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afii_
  • Chain 'J':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afij_
  • Chain 'K':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afik_
  • Chain 'L':
    Compound: Nitrogenase molybdenum-iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afil_
  • Chain 'M':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afim_
  • Chain 'N':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afin_
  • Chain 'O':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afio_
  • Chain 'P':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2afip_
  • Heterogens: HCA, CFN, CA, CLF, MG, ADP, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2afiA (A:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiA (A:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afiB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2afiC (C:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiC (C:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afiD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2afiE (E:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiE (E:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmef
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2afiF (F:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiF (F:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgime
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2afiG (G:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiG (G:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmde
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2afiH (H:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiH (H:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
    aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
    vfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
    licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
    alarkvvdnkllvipnpitmdeleellme
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2afiI (I:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiI (I:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afiJ (J:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2afiK (K:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiK (K:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afiL (L:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2afiM (M:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiM (M:)
    qcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimemaae
    agtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvf
    ydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggli
    cnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyral
    arkvvdnkllvipnpitmdeleellmef
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2afiN (N:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiN (N:)
    qcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimemaae
    agtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvf
    ydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggli
    cnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyral
    arkvvdnkllvipnpitmdeleellmefgi
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2afiO (O:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiO (O:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
    aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
    vfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
    licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
    alarkvvdnkllvipnpitmde
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2afiP (P:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afiP (P:)
    aiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimemaaeag
    tvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvfyd
    vlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgglicn
    srntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyralar
    kvvdnkllvipnpitmdeleellmefg