PDB entry 2afg

View 2afg on RCSB PDB site
Description: 2.0 angstrom x-ray structure of human acidic fibroblast growth factor
Class: growth factor
Keywords: growth factor
Deposited on 1995-07-21, released 1995-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2afga_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2afgb_
  • Chain 'C':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2afgc_
  • Chain 'D':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2afgd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2afgA (A:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afgA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2afgB (B:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afgB (B:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2afgC (C:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afgC (C:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2afgD (D:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afgD (D:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpvs