PDB entry 2afg

View 2afg on RCSB PDB site
Description:
Deposited on 1995-07-21, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2afga_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2afgb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2afgc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2afgd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afgA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afgB (B:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afgC (C:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2afgD (D:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpvs