PDB entry 2aff

View 2aff on RCSB PDB site
Description: The solution structure of the Ki67FHA/hNIFK(226-269)3P complex
Class: cell cycle
Keywords: Ki67; FHA; NIFK; NMR; Phosphoprotein, CELL CYCLE
Deposited on 2005-07-25, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antigen Ki-67
    Species: Homo sapiens [TaxId:9606]
    Gene: MKI67
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2affa_
  • Chain 'B':
    Compound: MKI67 FHA domain interacting nucleolar phosphoprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: MKI67IP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2affA (A:)
    mwptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeail
    hnfsstnptqvngsvidepvrlkhgdvitiidrsfryeneslqngrkstefprkireqep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2affA (A:)
    ptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeailhn
    fsstnptqvngsvidepvrlkhgdvitiidrsfryene
    

  • Chain 'B':
    No sequence available.