PDB entry 2afb

View 2afb on RCSB PDB site
Description: Crystal structure of 2-dehydro-3- deoxygluconokinase (EC 2.7.1.45) (tm0067) from THERMOTOGA MARITIMA at 2.05 A resolution
Class: transferase
Keywords: tm0067, 2-dehydro-3- deoxygluconokinase, pfkB family carbohydrate kinase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSFERASE
Deposited on 2005-07-25, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0067
    Database cross-references and differences (RAF-indexed):
    • GB NP_227883 (12-End)
      • leader sequence (7-11)
      • modified residue (12)
      • modified residue (21)
      • modified residue (56)
      • modified residue (192)
      • modified residue (196)
      • modified residue (266)
      • modified residue (303)
    Domains in SCOPe 2.08: d2afba2, d2afba3
  • Chain 'B':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0067
    Database cross-references and differences (RAF-indexed):
    • GB NP_227883 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (21)
      • modified residue (56)
      • modified residue (192)
      • modified residue (196)
      • modified residue (266)
      • modified residue (303)
    Domains in SCOPe 2.08: d2afbb2, d2afbb3
  • Heterogens: NI, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2afbA (A:)
    mgsdkihhhhhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgld
    ayfvtklpnnplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahs
    aiseakredfdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyr
    arlwtkeeaqkvmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeev
    trkynfktvgitlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliy
    gslmgfdsqkkaefaaaasclkhtipgdfvvlsieeieklasgatsgrver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afbA (A:)
    hhhhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtkl
    pnnplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakr
    edfdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtke
    eaqkvmipfmeyvdvlianeediekvlgisveglnreayakiaeevtrkynfktvgitlr
    esisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaef
    aaaasclkhtipgdfvvlsieeieklasg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2afbB (B:)
    mgsdkihhhhhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgld
    ayfvtklpnnplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahs
    aiseakredfdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyr
    arlwtkeeaqkvmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeev
    trkynfktvgitlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliy
    gslmgfdsqkkaefaaaasclkhtipgdfvvlsieeieklasgatsgrver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afbB (B:)
    hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
    lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
    wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
    vmipfmeyvdvlianeediekvlgisvegldnreayakiaeevtrkynfktvgitlresi
    satvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaa
    asclkhtipgdfvvlsieeieklasg