PDB entry 2afa

View 2afa on RCSB PDB site
Description: Crystal Structure of putative NAG isomerase from Salmonella typhimurium
Class: isomerase
Keywords: NAG isomerase, Dimer-of-Trimers, renin-binding protein, alpha/alpha-fold, T1489, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2005-07-25, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAG isomerase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yihS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKT7 (3-End)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
    Domains in SCOPe 2.07: d2afaa1, d2afaa2
  • Chain 'B':
    Compound: NAG isomerase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yihS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKT7 (3-End)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
    Domains in SCOPe 2.07: d2afab2, d2afab3
  • Chain 'C':
    Compound: NAG isomerase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yihS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKT7 (3-End)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
    Domains in SCOPe 2.07: d2afac2, d2afac3
  • Chain 'D':
    Compound: NAG isomerase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yihS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKT7 (3-End)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
    Domains in SCOPe 2.07: d2afad2, d2afad3
  • Chain 'E':
    Compound: NAG isomerase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yihS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKT7 (3-End)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
    Domains in SCOPe 2.07: d2afae2, d2afae3
  • Chain 'F':
    Compound: NAG isomerase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yihS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKT7 (3-End)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
      • cloning artifact (2)
      • modified residue (47)
      • modified residue (57)
      • modified residue (67)
      • modified residue (83)
      • modified residue (154)
      • modified residue (176)
      • modified residue (257)
      • modified residue (323)
      • modified residue (354)
    Domains in SCOPe 2.07: d2afaf2, d2afaf3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2afaA (A:)
    mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlh
    vysvaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffall
    gaasavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhav
    eaflivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahr
    frayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgf
    vysvdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyeng
    swwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinakeggsh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afaA (A:)
    lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
    svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
    asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
    flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
    ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
    svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
    wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2afaB (B:)
    mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlh
    vysvaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffall
    gaasavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhav
    eaflivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahr
    frayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgf
    vysvdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyeng
    swwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinakeggsh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afaB (B:)
    lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
    svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
    asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
    flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
    ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
    svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
    wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2afaC (C:)
    mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlh
    vysvaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffall
    gaasavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhav
    eaflivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahr
    frayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgf
    vysvdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyeng
    swwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinakeggsh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afaC (C:)
    lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
    svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
    asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
    flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
    ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
    svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
    wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2afaD (D:)
    mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlh
    vysvaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffall
    gaasavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhav
    eaflivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahr
    frayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgf
    vysvdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyeng
    swwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinakeggsh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afaD (D:)
    lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
    svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
    asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
    flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
    ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
    svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
    wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2afaE (E:)
    mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlh
    vysvaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffall
    gaasavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhav
    eaflivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahr
    frayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgf
    vysvdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyeng
    swwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinakeggsh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afaE (E:)
    lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
    svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
    asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
    flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
    ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
    svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
    wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2afaF (F:)
    mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlh
    vysvaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffall
    gaasavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhav
    eaflivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahr
    frayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgf
    vysvdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyeng
    swwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinakeggsh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afaF (F:)
    lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
    svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
    asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
    flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
    ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
    svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
    wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina