PDB entry 2af3

View 2af3 on RCSB PDB site
Description: Phosphotransacetylase from Methanosarcina thermophila soaked with Coenzyme A
Class: transferase
Keywords: Pta dimer soaked with Coenzyme A, acyltransferase, transferase
Deposited on 2005-07-25, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Phosphate acetyltransferase
    Species: Methanosarcina thermophila [TaxId:2210]
    Gene: pta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2af3c_
  • Chain 'D':
    Compound: Phosphate acetyltransferase
    Species: Methanosarcina thermophila [TaxId:2210]
    Gene: pta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2af3d_
  • Heterogens: SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2af3C (C:)
    mvtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdl
    dlskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgv
    vsgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsv
    edvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaid
    gelqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqg
    lakpindlsrgcsdedivgavaitcvqaaaqdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af3C (C:)
    vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
    lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
    sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
    dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
    elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
    akpindlsrgcsdedivgavaitcvqaaaqdk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2af3D (D:)
    mvtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdl
    dlskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgv
    vsgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsv
    edvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaid
    gelqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqg
    lakpindlsrgcsdedivgavaitcvqaaaqdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af3D (D:)
    vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
    lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
    sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
    dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
    elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
    akpindlsrgcsdedivgavaitcvqaaaqdk