PDB entry 2af2

View 2af2 on RCSB PDB site
Description: Solution structure of disulfide reduced and copper depleted Human Superoxide Dismutase
Class: Oxidoreductase
Keywords: Human superoxide dismutase, solution structure, NMR, homodimeric protein, disulfide bond reduced, copper depleted protein, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2005-07-25, released 2005-11-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-28, with a file datestamp of 2007-07-20.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: HOMO SAPIENS
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (110)
    Domains in SCOP 1.75: d2af2a1
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: HOMO SAPIENS
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (110)
    Domains in SCOP 1.75: d2af2b1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2af2A (A:)
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2af2B (B:)
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq